Cagrilintide (10MG)

$89.99

Shipping  Calculated at checkout.

Availability: 119 in stock

- +
Buy 1 - 2 pieces
$89.99
Total:
$89.99
3% off
Buy 3 - 4 and save 3%
$89.99
$87.29
Total:
5% off
Buy 5 - 9 and save 5%
$89.99
$85.49
Total:
10% off
Buy 10+ and save 10%
$89.99
$80.99
Total:
Low Stock | Order now

FREE SHIPPING

99%+ PURITY

MADE IN USA

what is this iron peptides product

What is Cagrilintide (10MG)?

Cagrilintide is a long-acting synthetic peptide analogue of human amylin, engineered for dual activation of amylin and calcitonin receptors (DACRA). It is designed with specific amino acid substitutions and N-terminal acylation (a fatty acid side chain) to enhance metabolic stability and prolong its half-life.
In research models, Cagrilintide is studied for its role in appetite regulation, gastric emptying, and energy balance, acting primarily through central and peripheral pathways involved in metabolic control. It remains strictly a research compound, not intended for therapeutic or dietary use.
Structure of Chemicals iron peptides

Chemical Structure of Cagrilintide (10MG)

  • Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

  • Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂

  • Molecular Weight: 4,409.01 g/mol

  • CAS Number: 1415456-99-3

  • Synonyms: AM833, AT42613

  • Structure Features: The peptide is acylated with a C20 di-acid fatty chain, which improves albumin binding and extends its biological half-life to approximately 160–190 hours in test systems.

  • Form: White lyophilized powder, soluble in aqueous buffers.

Medical iron peptides

What Are the Effects of Cagrilintide (10MG)?

Appetite Regulation and Gastric Emptying — Studies indicate Cagrilintide activates amylin receptors in the brainstem regions (e.g., area postrema and nucleus tractus solitarius), leading to reduced food intake and delayed gastric emptying.

Energy and Weight Research Models — In experimental settings, Cagrilintide has been shown to enhance energy balance and contribute to weight reduction when administered alone or in combination with GLP-1 receptor agonists. Combination studies (e.g., with semaglutide) demonstrated synergistic effects in reducing body weight and improving metabolic parameters in research animals.

Metabolic & Glycemic Modulation — Data from preclinical and early human research demonstrate reductions in glucagon levels, modest improvements in fasting glucose, and better insulin sensitivity in metabolic studies.

Pharmacokinetic Advantages — Due to its acylated structure, Cagrilintide exhibits a long elimination half-life (~160–195 hours), supporting sustained receptor engagement and stable activity with once-weekly administration schedules in experimental contexts.

Safety Observations — Controlled research trials report gastrointestinal events (e.g., transient nausea or fullness) as the most common findings, similar to other amylin analogs. No endocrine-related toxicities have been documented under study conditions.


Product & Quality Information

  • Purity: ≥99% (HPLC verified)

  • Solubility: Water and aqueous buffers

  • Storage: Store at –20°C, sealed and protected from light and moisture

  • Shelf Life: 36 months when stored properly

  • Manufacturing: USA-made, GMP-compliant, third-party tested for sterility and purity

  • Intended Use: In vitro and laboratory research only — not for human use


Legal Disclaimer

This compound is sold exclusively for research purposes. It is not approved for human or veterinary consumption, medical use, or as a dietary supplement. Handle only by qualified individuals with appropriate laboratory training. Keep out of reach of children. The supplier guarantees the purity and identity of the material only.

Add a review
Cagrilintide (10MG) Cagrilintide (10MG)
Rating*
0/5
* Rating is required
Your review
* Review is required
Name
* Name is required
* Please confirm that you are not a robot
0.0
Based on 0 reviews
5 star
0%
4 star
0%
3 star
0%
2 star
0%
1 star
0%
0 of 0 reviews

Sorry, no reviews match your current selections

TrustScore 4.3

Edgar Guzman

2026-01-20

I have been taking glp3 for a few…

I have been taking glp3 for a few months and I've been losing about 38 close to 40 lb. I feel great. Lots of energy. I definitely recommend iron. It's to me the most trusted legit company customer service It's amazing. They always have discounts. They always have promotions so if you want to see results go with IRON that's for sure

JC

Jcoop

2026-01-16

Amazing service top-notch products

Amazing service top-notch products, I always receive my peptides within a few days of placing my order.

PV

Paola Vargas

2026-01-16

I have try peptides Reta and it’s so…

I have try peptides Reta and it’s so good helping me with better habits and eating well I feel more energy and my progress it’s easier , very focus and the guiadance on usage it’s so good any questions they are there for you . Def recommend

Shopping Cart
Purchase Cagrilintide for research purposes. Premium-quality peptide designed for scientific studies on metabolic processes and weight managementCagrilintide (10MG)
$89.99

Availability: 119 in stock

- +
Buy 1 - 2 pieces
$89.99
Total:
$89.99
3% off
Buy 3 - 4 and save 3%
$89.99
$87.29
Total:
5% off
Buy 5 - 9 and save 5%
$89.99
$85.49
Total:
10% off
Buy 10+ and save 10%
$89.99
$80.99
Total:
Scroll to Top